
Atlas Antibodies Anti-SLC26A6 Antibody
상품 한눈에 보기
Human SLC26A6 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. 재조합 발현 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 고품질의 특이적 신호를 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC26A6 Antibody
Target: solute carrier family 26 (anion exchanger), member 6
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, recombinant expression validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human SLC26A6.
Alternative Gene Names
- DKFZp586E1422
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 26 (anion exchanger), member 6 |
| Target Gene | SLC26A6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQAASPKGASVSINVNTSLEDMRSNNVEDCKMMQVS |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000107138 | 60% |
| Rat | ENSRNOG00000020450 | 59% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC27A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC27A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC26A6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC26A9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC26A8 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.