CacheBy
Atlas Antibodies Anti-SLC26A9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC26A9 Antibody

상품 한눈에 보기

Human SLC26A9 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. RNA-seq 기반 직교 검증을 거쳤으며, 고순도의 친화 정제 방식으로 제조되었습니다. PBS/glycerol 완충액에 보존제로 sodium azide가 포함되어 있습니다.

카탈로그번호
HPA051485-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051485-100 Anti-SLC26A9 Antibody, solute carrier family 26 (anion exchanger), member 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051485-25 Anti-SLC26A9 Antibody, solute carrier family 26 (anion exchanger), member 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC26A9 Antibody

Anti-SLC26A9 Antibody

Target: solute carrier family 26 (anion exchanger), member 9
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data in high and low expression tissues.
  • ICC: Suitable for immunocytochemistry analysis.

Product Description

Polyclonal antibody against human SLC26A9.
Validated using orthogonal methods and affinity purified for high specificity.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Solute carrier family 26 (anion exchanger), member 9
Target Gene SLC26A9
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRC
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000042268 (91%), Rat ENSRNOG00000029514 (91%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.