CacheBy
Atlas Antibodies Anti-SLC25A46 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A46 Antibody

상품 한눈에 보기

Human SLC25A46 단백질을 인식하는 Rabbit Polyclonal 항체. WB 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증되었으며, 40% glycerol 기반 PBS buffer에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA071582-100 Anti-SLC25A46 Antibody, solute carrier family 25, member 46 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071582-25 Anti-SLC25A46 Antibody, solute carrier family 25, member 46 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A46 Antibody

Anti-SLC25A46 Antibody

Target: Solute carrier family 25, member 46 (SLC25A46)
Type: Polyclonal Antibody against Human SLC25A46


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human SLC25A46, purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Solute carrier family 25, member 46
Target Gene SLC25A46
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RPDGFDGLGYRGGARDEQGFGGAFPARSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEPFSSGGGGSVQGQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000017091 (70%)
  • Mouse ENSMUSG00000024259 (69%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.