CacheBy
Atlas Antibodies Anti-SLC25A46 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A46 Antibody

상품 한눈에 보기

Human SLC25A46 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 ICC에 적합. PrEST 항원을 이용한 친화 정제 방식으로 고순도 확보. PBS와 글리세롤 기반 버퍼에 보존제 포함. 다양한 종 간 반응성 정보 제공.

카탈로그번호
HPA039601-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039601-100 Anti-SLC25A46 Antibody, solute carrier family 25, member 46 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039601-25 Anti-SLC25A46 Antibody, solute carrier family 25, member 46 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A46 Antibody

Anti-SLC25A46 Antibody

Target: solute carrier family 25, member 46
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SLC25A46.
For detailed information, see the Open Datasheet.


Target Information

항목 내용
Target Protein solute carrier family 25, member 46
Target Gene SLC25A46
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence RPDGFDGLGYRGGARDEQGFGGAFPARSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEPFSSGGGGSVQGQ

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000017091 (70%)
  • Mouse ENSMUSG00000024259 (69%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.