
Atlas Antibodies Anti-SLC25A43 Antibody
상품 한눈에 보기
Human SLC25A43 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인체 반응성이 검증된 고품질 연구용 시약입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC25A43 Antibody
Target: Solute carrier family 25, member 43 (SLC25A43)
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human SLC25A43.
Target Information
- Target Protein: Solute carrier family 25, member 43
- Target Gene: SLC25A43
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQIVKAQ
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000037636 (89%)
- Rat ENSRNOG00000012756 (89%)
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Verified Reactivity | Human |
| Applications | IHC, ICC |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC25A45 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC25A43 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC25A43 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC25A42 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC25A40 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.