CacheBy
Atlas Antibodies Anti-SLC25A40 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A40 Antibody

상품 한눈에 보기

Human SLC25A40 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. Affinity purification 방식으로 높은 특이성과 재현성을 제공. 40% glycerol 기반 버퍼로 안정한 장기 보관 가능.

카탈로그번호
HPA055197-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055197-100 Anti-SLC25A40 Antibody, solute carrier family 25, member 40 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055197-25 Anti-SLC25A40 Antibody, solute carrier family 25, member 40 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A40 Antibody

Anti-SLC25A40 Antibody

Target: solute carrier family 25, member 40 (SLC25A40)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human SLC25A40.


Alternative Gene Names

  • MCFP

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 25, member 40
Target Gene SLC25A40
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FVYSNGLMDHLCVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000054099 80%
Rat ENSRNOG00000022837 78%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.