
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC25A17 Antibody
상품 한눈에 보기
인간 SLC25A17 단백질을 인식하는 토끼 폴리클로날 항체. 퍼옥시좀 막 단백질 연구에 적합하며, IgG 아이소타입. 고순도 친화 정제 제품으로 인체 반응성 검증 완료. IHC 등 다양한 응용에 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA052708-100 Anti-SLC25A17 Antibody, solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052708-25 Anti-SLC25A17 Antibody, solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC25A17 Antibody
Anti-SLC25A17 Antibody
Target: solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17
Alternative Gene Name: PMP34
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human SLC25A17.
Recommended Applications
- Immunohistochemistry (IHC)
Target Information
- Target Protein: solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17
- Target Gene: SLC25A17
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000022404 | 97% |
| Rat | ENSRNOG00000018920 | 97% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



