Atlas Antibodies Anti-SLC25A17 Antibody

상품 한눈에 보기

인간 SLC25A17 단백질을 인식하는 토끼 폴리클로날 항체. 퍼옥시좀 막 단백질 연구에 적합하며, IgG 아이소타입. 고순도 친화 정제 제품으로 인체 반응성 검증 완료. IHC 등 다양한 응용에 사용 가능.

카탈로그번호: HPA052708-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA052708-100 Anti-SLC25A17 Antibody, solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA052708-25 Anti-SLC25A17 Antibody, solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC25A17 Antibody

Anti-SLC25A17 Antibody

Target: solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17
Alternative Gene Name: PMP34
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human SLC25A17.

Recommended Applications

Immunohistochemistry (IHC)

Target Information

Target Protein: solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17
Target Gene: SLC25A17
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR

Verified Species Reactivity

Human

Interspecies Information

Species	Ortholog ID	Sequence Identity
Mouse	ENSMUSG00000022404	97%
Rat	ENSRNOG00000018920	97%

Antibody Properties

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet