Atlas Antibodies Anti-SLC25A17 Antibody
상품 옵션 정보 | |||||||
---|---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA052708-100 | Atlas Antibodies HPA052708-100 Anti-SLC25A17 Antibody, solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA052708-25 | Atlas Antibodies HPA052708-25 Anti-SLC25A17 Antibody, solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-SLC25A17 Antibody
solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17
Recommended Applications
Product Description
Polyclonal Antibody against Human SLC25A17
Alternative Gene Names
PMP34
Target Protein
solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17
Target Gene
SLC25A17
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000022404 (97%)
Rat ENSRNOG00000018920 (97%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|