원본
Atlas Antibodies Anti-SLC25A16 Antibody
상품 한눈에 보기
인간 SLC25A16 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종간 보존성으로 Rat(91%), Mouse(89%)에서도 반응 가능.
- 카탈로그번호
- HPA044580-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044580-100 Anti-SLC25A16 Antibody, solute carrier family 25 (mitochondrial carrier), member 16 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044580-25 Anti-SLC25A16 Antibody, solute carrier family 25 (mitochondrial carrier), member 16 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC25A16 Antibody
Anti-SLC25A16 Antibody
Target Information
- Protein: Solute carrier family 25 (mitochondrial carrier), member 16
- Gene: SLC25A16
- Alternative Gene Names: D10S105E, GDA, HGT.1, ML7
Recommended Applications
면역세포화학 (ICC)
Product Description
Polyclonal Antibody against Human SLC25A16
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
RMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLY
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000000387 | 91% |
| Mouse | ENSMUSG00000071253 | 89% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.