CacheBy
Atlas Antibodies Anti-SLC19A3 Antibody
원본

Atlas Antibodies Anti-SLC19A3 Antibody

상품 한눈에 보기

Human SLC19A3 단백질을 인식하는 토끼 폴리클로날 항체로, 티아민 수송체 연구에 적합. IHC 및 WB 응용에 권장되며, PrEST 항원으로 친화 정제됨. PBS와 글리세롤 버퍼에 보존되어 안정적 사용 가능.

카탈로그번호
HPA038898-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038898-100 Anti-SLC19A3 Antibody, solute carrier family 19 (thiamine transporter), member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038898-25 Anti-SLC19A3 Antibody, solute carrier family 19 (thiamine transporter), member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC19A3 Antibody

Anti-SLC19A3 Antibody

Target: solute carrier family 19 (thiamine transporter), member 3
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human SLC19A3 (solute carrier family 19, thiamine transporter, member 3).

Alternative Gene Names

  • THTR2

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein solute carrier family 19 (thiamine transporter), member 3
Target Gene SLC19A3
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000056562 (27%), Mouse ENSMUSG00000053007 (26%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
KKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECY

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.