
원본
Atlas Antibodies Anti-SLC19A3 Antibody
상품 한눈에 보기
Human SLC19A3 단백질을 인식하는 토끼 폴리클로날 항체로, 티아민 수송체 연구에 적합. IHC 및 WB 응용에 권장되며, PrEST 항원으로 친화 정제됨. PBS와 글리세롤 버퍼에 보존되어 안정적 사용 가능.
- 카탈로그번호
- HPA038898-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038898-100 Anti-SLC19A3 Antibody, solute carrier family 19 (thiamine transporter), member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038898-25 Anti-SLC19A3 Antibody, solute carrier family 19 (thiamine transporter), member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC19A3 Antibody
Anti-SLC19A3 Antibody
Target: solute carrier family 19 (thiamine transporter), member 3
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human SLC19A3 (solute carrier family 19, thiamine transporter, member 3).
Alternative Gene Names
- THTR2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 19 (thiamine transporter), member 3 |
| Target Gene | SLC19A3 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000056562 (27%), Mouse ENSMUSG00000053007 (26%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
KKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECY
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



