
Atlas Antibodies Anti-SLC19A3 Antibody
Human SLC19A3 단백질을 인식하는 토끼 폴리클로날 항체로, 티아민 수송체 연구에 적합. IHC 및 WB 응용에 권장되며, PrEST 항원으로 친화 정제됨. PBS와 글리세롤 버퍼에 보존되어 안정적 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC19A3 Antibody
Target: solute carrier family 19 (thiamine transporter), member 3
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human SLC19A3 (solute carrier family 19, thiamine transporter, member 3).
Alternative Gene Names
- THTR2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 19 (thiamine transporter), member 3 |
| Target Gene | SLC19A3 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000056562 (27%), Mouse ENSMUSG00000053007 (26%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
KKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECY
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC1A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC1A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC19A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC17A4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC19A1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|