CacheBy
Atlas Antibodies Anti-SLC19A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC19A1 Antibody

상품 한눈에 보기

Human SLC19A1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 특이적 정제됨. Folate transporter 연구 및 SLC19A1 관련 단백질 분석에 활용 가능.

카탈로그번호
HPA024802-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024802-100 Anti-SLC19A1 Antibody, solute carrier family 19 (folate transporter), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024802-25 Anti-SLC19A1 Antibody, solute carrier family 19 (folate transporter), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC19A1 Antibody

Anti-SLC19A1 Antibody

Target: solute carrier family 19 (folate transporter), member 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SLC19A1


Alternative Gene Names

  • FOLT

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 19 (folate transporter), member 1
Target Gene SLC19A1
Verified Species Reactivity Human
Interspecies Identity Mouse (28%), Rat (27%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNV


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.