
Atlas Antibodies Anti-SLC12A2 Antibody
상품 한눈에 보기
Human SLC12A2 단백질을 인식하는 토끼 폴리클로날 항체로, NKCC1로도 알려진 나트륨/칼륨/염화물 수송체 연구에 적합. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원을 이용해 친화 정제됨. 인간 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC12A2 Antibody
Target: solute carrier family 12 (sodium/potassium/chloride transporter), member 2
Type: Polyclonal Antibody against Human SLC12A2
Recommended Applications
- Immunohistochemistry (IHC)
Alternative Gene Names
BSC, BSC2, NKCC1, PPP1R141
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 12 (sodium/potassium/chloride transporter), member 2 |
| Target Gene | SLC12A2 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | TLVLGFKKDWLQADMRDVDMYINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSE |
Species Reactivity
- Verified: Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000015971 | 91% |
| Mouse | ENSMUSG00000024597 | 91% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC12A9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC12A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC12A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC12A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC11A1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.