CacheBy
Atlas Antibodies Anti-SLC12A3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC12A3 Antibody

상품 한눈에 보기

인간 SLC12A3 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 RNA-seq 데이터 비교를 통한 직교 검증 완료. 토끼 유래 IgG, PrEST 항원으로 정제. 인간 반응성 검증 및 높은 종간 서열 동일성 보유.

카탈로그번호
HPA028748-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028748-100 Anti-SLC12A3 Antibody, solute carrier family 12 (sodium/chloride transporter), member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028748-25 Anti-SLC12A3 Antibody, solute carrier family 12 (sodium/chloride transporter), member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC12A3 Antibody

Anti-SLC12A3 Antibody

solute carrier family 12 (sodium/chloride transporter), member 3

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SLC12A3

Alternative Gene Names

  • NCCT

Open Datasheet

Target Information

항목 내용
Target Protein solute carrier family 12 (sodium/chloride transporter), member 3
Target Gene SLC12A3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000031766 (90%) / Rat ENSRNOG00000057072 (90%)

Antigen Sequence

LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Reference Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.