
Atlas Antibodies Anti-SLAMF9 Antibody
상품 한눈에 보기
Human SLAMF9 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공하며, 인간 시료 분석에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLAMF9 Antibody
Target: SLAM family member 9 (SLAMF9)
Type: Polyclonal Antibody against Human SLAMF9
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human SLAMF9 protein.
Alternative Gene Names
CD2F-10, CD84-H1, SF2001
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SLAM family member 9 |
| Target Gene | SLAMF9 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAF |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000008045 (67%), Mouse ENSMUSG00000026548 (67%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC10A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC10A5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLAMF9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC10A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLAMF8 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.