CacheBy
Atlas Antibodies Anti-SLC10A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC10A2 Antibody

상품 한눈에 보기

Human SLC10A2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. ASBT/ISBT 대체 유전자명으로도 알려짐. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 버퍼에 보존됨.

카탈로그번호
HPA004795-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004795-100 Anti-SLC10A2 Antibody, solute carrier family 10 (sodium/bile acid cotransporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004795-25 Anti-SLC10A2 Antibody, solute carrier family 10 (sodium/bile acid cotransporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC10A2 Antibody

Anti-SLC10A2 Antibody

Target: solute carrier family 10 (sodium/bile acid cotransporter), member 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human SLC10A2

Alternative Gene Names: ASBT, ISBT
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 10 (sodium/bile acid cotransporter), member 2
Target Gene SLC10A2
Antigen Sequence NKAEIPESKENGTEPESSFYKANGGFQPDE
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000023073 (47%)
Rat ENSRNOG00000003302 (42%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.