
원본
Atlas Antibodies Anti-SKA1 Antibody
상품 한눈에 보기
인간 SKA1 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC에 사용 가능. siRNA 노크다운을 통한 유전적 검증 완료. 토끼 유래 IgG로 친화 정제된 고품질 항체. 40% 글리세롤 및 PBS 버퍼에 보존제 포함.
- 카탈로그번호
- HPA045495-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA045495-100 Anti-SKA1 Antibody, spindle and kinetochore associated complex subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045495-25 Anti-SKA1 Antibody, spindle and kinetochore associated complex subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SKA1 Antibody
Anti-SKA1 Antibody
Target: spindle and kinetochore associated complex subunit 1 (SKA1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Genetic validation by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human SKA1
Alternative Gene Names
- C18orf24
- MGC10200
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | spindle and kinetochore associated complex subunit 1 |
| Target Gene | SKA1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (76%), Mouse (70%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Antigen Sequence
ELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENIPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEM
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



