CacheBy
Atlas Antibodies Anti-SKA1 Antibody
원본

Atlas Antibodies Anti-SKA1 Antibody

상품 한눈에 보기

인간 SKA1 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC에 사용 가능. siRNA 노크다운을 통한 유전적 검증 완료. 토끼 유래 IgG로 친화 정제된 고품질 항체. 40% 글리세롤 및 PBS 버퍼에 보존제 포함.

카탈로그번호
HPA045495-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045495-100 Anti-SKA1 Antibody, spindle and kinetochore associated complex subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045495-25 Anti-SKA1 Antibody, spindle and kinetochore associated complex subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SKA1 Antibody

Anti-SKA1 Antibody

Target: spindle and kinetochore associated complex subunit 1 (SKA1)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human SKA1

Alternative Gene Names

  • C18orf24
  • MGC10200

Open Datasheet

Target Information

항목 내용
Target Protein spindle and kinetochore associated complex subunit 1
Target Gene SKA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (76%), Mouse (70%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Antigen Sequence

ELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENIPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEM

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC
WB Genetic
Genetic Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.