CacheBy
Atlas Antibodies Anti-SIX5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SIX5 Antibody

상품 한눈에 보기

Human SIX5 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042068-100 Anti-SIX5 Antibody, SIX homeobox 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042068-25 Anti-SIX5 Antibody, SIX homeobox 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SIX5 Antibody

Anti-SIX5 Antibody

Target Information

  • Target Protein: SIX homeobox 5
  • Target Gene: SIX5
  • Alternative Gene Names: DMAHP

이미지: IHC (Immunohistochemistry)

Product Description

Polyclonal antibody against human SIX5.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VVPTSQVVTLPQAVGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFLLANPVSGSPIVTGVAVQQGKIILTATFPTSMLVSQVLP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000040841): 97%
  • Rat (ENSRNOG00000060146): 90%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.