Thermo Fisher Scientific IL-6 Receptor (CD126) Polyclonal Antibody
Human IL-6 Receptor(CD126)에 특이적인 Rabbit Polyclonal Antibody로 Western blot에 적합. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 재구성 시 500 µg/mL 농도. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- View 1 publication
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Published Species | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R (379–419aa: LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746622 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor.
This gene encodes a subunit of the interleukin 6 (IL6) receptor complex.
Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response.
The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines.
Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases, and prostate cancer.
Alternatively spliced transcript variants encoding distinct isoforms have been reported.
A pseudogene of this gene is found on chromosome 9.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific IL-4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IL-4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IL-6 Receptor (CD126) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IL1F6 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IL-7 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|