
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EIF4EBP1 Antibody
상품 한눈에 보기
Human EIF4EBP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western Blot에 적합합니다. 4E-BP1/PHAS-I로도 알려진 EIF4EBP1을 타깃하며, 고순도의 Affinity 정제 방식으로 제조되었습니다. Human, Mouse, Rat에서 반응이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023501-100 Anti-EIF4EBP1 Antibody, eukaryotic translation initiation factor 4E binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023501-25 Anti-EIF4EBP1 Antibody, eukaryotic translation initiation factor 4E binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EIF4EBP1 Antibody
Anti-EIF4EBP1 Antibody
Target: eukaryotic translation initiation factor 4E binding protein 1 (EIF4EBP1)
Type: Polyclonal Antibody against Human EIF4EBP1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
This polyclonal antibody targets the human EIF4EBP1 protein, also known as eukaryotic translation initiation factor 4E binding protein 1. It is affinity purified and suitable for various research applications.
Alternative Gene Names
- 4E-BP1
- PHAS-I
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | eukaryotic translation initiation factor 4E binding protein 1 |
| Target Gene | EIF4EBP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000012582 | 92% |
| Mouse | ENSMUSG00000031490 | 89% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



