CacheBy
Atlas Antibodies Anti-EIF4EBP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EIF4EBP1 Antibody

상품 한눈에 보기

Human EIF4EBP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western Blot에 적합합니다. 4E-BP1/PHAS-I로도 알려진 EIF4EBP1을 타깃하며, 고순도의 Affinity 정제 방식으로 제조되었습니다. Human, Mouse, Rat에서 반응이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023501-100 Anti-EIF4EBP1 Antibody, eukaryotic translation initiation factor 4E binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023501-25 Anti-EIF4EBP1 Antibody, eukaryotic translation initiation factor 4E binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EIF4EBP1 Antibody

Anti-EIF4EBP1 Antibody

Target: eukaryotic translation initiation factor 4E binding protein 1 (EIF4EBP1)
Type: Polyclonal Antibody against Human EIF4EBP1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

This polyclonal antibody targets the human EIF4EBP1 protein, also known as eukaryotic translation initiation factor 4E binding protein 1. It is affinity purified and suitable for various research applications.


Alternative Gene Names

  • 4E-BP1
  • PHAS-I

Target Information

항목 내용
Target Protein eukaryotic translation initiation factor 4E binding protein 1
Target Gene EIF4EBP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000012582 92%
Mouse ENSMUSG00000031490 89%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.