
Atlas Antibodies Anti-EIF4EBP1 Antibody
Human EIF4EBP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western Blot에 적합합니다. 4E-BP1/PHAS-I로도 알려진 EIF4EBP1을 타깃하며, 고순도의 Affinity 정제 방식으로 제조되었습니다. Human, Mouse, Rat에서 반응이 검증되었습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-EIF4EBP1 Antibody
Target: eukaryotic translation initiation factor 4E binding protein 1 (EIF4EBP1)
Type: Polyclonal Antibody against Human EIF4EBP1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
This polyclonal antibody targets the human EIF4EBP1 protein, also known as eukaryotic translation initiation factor 4E binding protein 1. It is affinity purified and suitable for various research applications.
Alternative Gene Names
- 4E-BP1
- PHAS-I
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | eukaryotic translation initiation factor 4E binding protein 1 |
| Target Gene | EIF4EBP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000012582 | 92% |
| Mouse | ENSMUSG00000031490 | 89% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-EIF4ENIF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF4EBP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF4EBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF4E3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF4E3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|