
Atlas Antibodies Anti-EIF4E3 Antibody
Rabbit polyclonal antibody against human EIF4E3. Affinity purified using PrEST antigen. Suitable for immunocytochemistry and related applications. Provides high specificity and cross-reactivity with rat and mouse orthologs (96% identity).
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-EIF4E3 Antibody
Target: eukaryotic translation initiation factor 4E family member 3 (EIF4E3)
Supplier: Atlas Antibodies
Recommended Applications
Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human EIF4E3.
Alternative Gene Names
- MGC39820
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | eukaryotic translation initiation factor 4E family member 3 |
| Target Gene | EIF4E3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIY |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000010301 (96%), Mouse ENSMUSG00000093661 (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Information
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-EIF4EBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF4E3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF4E3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF4E2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF4E1B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|