CacheBy
Atlas Antibodies Anti-EEF1A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EEF1A1 Antibody

상품 한눈에 보기

Human EEF1A1 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 affinity purification 방식으로 제조되었으며, 높은 종간 보존성을 보입니다. 40% glycerol 기반 buffer로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051759-100 Anti-EEF1A1 Antibody, eukaryotic translation elongation factor 1 alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051759-25 Anti-EEF1A1 Antibody, eukaryotic translation elongation factor 1 alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EEF1A1 Antibody

Anti-EEF1A1 Antibody

Target: eukaryotic translation elongation factor 1 alpha 1 (EEF1A1)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human EEF1A1.

Alternative Gene Names

EE1A1, EEF1A, EF1A, LENG7

Open Datasheet

Target Information

  • Target Protein: eukaryotic translation elongation factor 1 alpha 1
  • Target Gene: EEF1A1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000012477): 100%
  • Mouse (ENSMUSG00000016349): 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.