
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EEF1A1 Antibody
상품 한눈에 보기
Human EEF1A1 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 affinity purification 방식으로 제조되었으며, 높은 종간 보존성을 보입니다. 40% glycerol 기반 buffer로 안정화되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051759-100 Anti-EEF1A1 Antibody, eukaryotic translation elongation factor 1 alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051759-25 Anti-EEF1A1 Antibody, eukaryotic translation elongation factor 1 alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EEF1A1 Antibody
Anti-EEF1A1 Antibody
Target: eukaryotic translation elongation factor 1 alpha 1 (EEF1A1)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human EEF1A1.
Alternative Gene Names
EE1A1, EEF1A, EF1A, LENG7
Target Information
- Target Protein: eukaryotic translation elongation factor 1 alpha 1
- Target Gene: EEF1A1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000012477): 100%
- Mouse (ENSMUSG00000016349): 100%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



