
Atlas Antibodies Anti-EEF1A1 Antibody
상품 한눈에 보기
Human EEF1A1 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 affinity purification 방식으로 제조되었으며, 높은 종간 보존성을 보입니다. 40% glycerol 기반 buffer로 안정화되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-EEF1A1 Antibody
Target: eukaryotic translation elongation factor 1 alpha 1 (EEF1A1)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human EEF1A1.
Alternative Gene Names
EE1A1, EEF1A, EF1A, LENG7
Target Information
- Target Protein: eukaryotic translation elongation factor 1 alpha 1
- Target Gene: EEF1A1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000012477): 100%
- Mouse (ENSMUSG00000016349): 100%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
