CacheBy
Atlas Antibodies Anti-EDN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EDN1 Antibody

상품 한눈에 보기

Human endothelin 1(EDN1)을 인식하는 Rabbit Polyclonal Antibody. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. PBS/glycerol buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031976-100 Anti-EDN1 Antibody, endothelin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031976-25 Anti-EDN1 Antibody, endothelin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EDN1 Antibody

Anti-EDN1 Antibody

Target Information

  • Target Protein: Endothelin 1
  • Target Gene: EDN1
  • Alternative Gene Names: ET1

Product Description

Polyclonal antibody against human EDN1.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
PYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat (ENSRNOG00000014361): 71%
  • Mouse (ENSMUSG00000021367): 69%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Additional Resources

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.