
Atlas Antibodies Anti-ECT2L Antibody
상품 한눈에 보기
Human ECT2L 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human에 대한 반응성이 검증되었습니다. 안정적인 PBS/glycerol 버퍼에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ECT2L Antibody
Target: epithelial cell transforming 2 like (ECT2L)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human ECT2L protein.
Alternative Gene Names
ARHGEF32, C6orf91, FBXO49, LFDH
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | epithelial cell transforming 2 like |
| Target Gene | ECT2L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GQKAQSIGIFSDGDSREINLLQGYKIGVKNLLRPEVRDFWEKLGSYVATEEEGGHVDFFVPLGASEAGIEVLSQ |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000071392 | 85% |
| Rat | ENSRNOG00000055142 | 81% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Recommended Applications
- Immunohistochemistry (IHC)
- Other applications to be optimized by the user
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
