AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ECT2L Antibody
상품 한눈에 보기
Human ECT2L 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human에 대한 반응성이 검증되었습니다. 안정적인 PBS/glycerol 버퍼에 보존되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035488-100 Anti-ECT2L Antibody, epithelial cell transforming 2 like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035488-25 Anti-ECT2L Antibody, epithelial cell transforming 2 like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ECT2L Antibody
Anti-ECT2L Antibody
Target: epithelial cell transforming 2 like (ECT2L)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human ECT2L protein.
Alternative Gene Names
ARHGEF32, C6orf91, FBXO49, LFDH
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | epithelial cell transforming 2 like |
| Target Gene | ECT2L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GQKAQSIGIFSDGDSREINLLQGYKIGVKNLLRPEVRDFWEKLGSYVATEEEGGHVDFFVPLGASEAGIEVLSQ |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000071392 | 85% |
| Rat | ENSRNOG00000055142 | 81% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Recommended Applications
- Immunohistochemistry (IHC)
- Other applications to be optimized by the user
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.