CacheBy
Atlas Antibodies Anti-ECSCR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ECSCR Antibody

상품 한눈에 보기

Human ECSCR 단백질을 인식하는 폴리클로날 항체로, 내피세포 표면의 화학주성 및 세포사 조절 연구에 적합함. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간에 대한 반응성이 검증되어 다양한 응용 가능.

카탈로그번호
HPA063337-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063337-100 Anti-ECSCR Antibody, endothelial cell surface expressed chemotaxis and apoptosis regulator 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063337-25 Anti-ECSCR Antibody, endothelial cell surface expressed chemotaxis and apoptosis regulator 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ECSCR Antibody

Anti-ECSCR Antibody

Target: Endothelial cell surface expressed chemotaxis and apoptosis regulator (ECSCR)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ECSCR.

Alternative Gene Names

  • ARIA
  • ECSM2

Open Datasheet (PDF)

Target Information

  • Target Protein: Endothelial cell surface expressed chemotaxis and apoptosis regulator
  • Target Gene: ECSCR
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEANRPSHLSSTGT

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000090588 40%
Rat ENSRNOG00000005564 37%

Antibody Properties

Specification Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.