CacheBy
Atlas Antibodies Anti-DUS3L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DUS3L Antibody

상품 한눈에 보기

인간 DUS3L 단백질을 표적으로 하는 폴리클로날 항체입니다. IHC 및 WB 실험에 적합하며, 인간·마우스·랫트 반응성이 검증되었습니다. Rabbit 호스트에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041854-100 Anti-DUS3L Antibody, dihydrouridine synthase 3-like (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041854-25 Anti-DUS3L Antibody, dihydrouridine synthase 3-like (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DUS3L Antibody

Anti-DUS3L Antibody

Target Information

  • Target Protein: dihydrouridine synthase 3-like (S. cerevisiae)
  • Target Gene: DUS3L
  • Alternative Gene Names: DUS3, FLJ13896
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human DUS3L.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQ

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000050381 91%
Mouse ENSMUSG00000007603 91%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.