Atlas Antibodies Anti-DUSP10 Antibody

상품 한눈에 보기

Human DUSP10 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합. Rabbit 유래 IgG로 PrEST 항원 친화 정제. Human에 대한 검증된 반응성과 높은 종간 보존성(98%)을 보임. 안정한 PBS/glycerol 버퍼에 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA016758-100 Anti-DUSP10 Antibody, dual specificity phosphatase 10 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA016758-25 Anti-DUSP10 Antibody, dual specificity phosphatase 10 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Dual specificity phosphatase 10 (DUSP10)
Type: Polyclonal Antibody against Human DUSP10

Polyclonal antibody targeting human DUSP10, also known as dual specificity phosphatase 10.

항목	내용
Target Protein	Dual specificity phosphatase 10
Target Gene	DUSP10
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	FMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQ

Verified: Human
Ortholog Identity:
- Rat ENSRNOG00000004003 (98%)
- Mouse ENSMUSG00000039384 (98%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)