
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DUSP10 Antibody
상품 한눈에 보기
Human DUSP10 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합. Rabbit 유래 IgG로 PrEST 항원 친화 정제. Human에 대한 검증된 반응성과 높은 종간 보존성(98%)을 보임. 안정한 PBS/glycerol 버퍼에 보존.
- 카탈로그번호
- HPA016758-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA016758-100 Anti-DUSP10 Antibody, dual specificity phosphatase 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016758-25 Anti-DUSP10 Antibody, dual specificity phosphatase 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DUSP10 Antibody
Anti-DUSP10 Antibody
Target: Dual specificity phosphatase 10 (DUSP10)
Type: Polyclonal Antibody against Human DUSP10
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody targeting human DUSP10, also known as dual specificity phosphatase 10.
Alternative Gene Names
- MKP-5
- MKP5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Dual specificity phosphatase 10 |
| Target Gene | DUSP10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | FMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQ |
Species Reactivity
- Verified: Human
- Ortholog Identity:
- Rat ENSRNOG00000004003 (98%)
- Mouse ENSMUSG00000039384 (98%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



