CacheBy
Atlas Antibodies Anti-DUSP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DUSP1 Antibody

상품 한눈에 보기

Human DUSP1 단백질을 인식하는 rabbit polyclonal 항체로, Western blot과 Immunocytochemistry에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 상동성을 보입니다. 40% glycerol 기반 PBS buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069577-100 Anti-DUSP1 Antibody, dual specificity phosphatase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069577-25 Anti-DUSP1 Antibody, dual specificity phosphatase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DUSP1 Antibody

Anti-DUSP1 Antibody

Target: Dual specificity phosphatase 1 (DUSP1)
Type: Polyclonal Antibody against Human DUSP1


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human DUSP1. This antibody recognizes the dual specificity phosphatase 1 protein, also known as DUSP1.


Alternative Gene Names

CL100, HVH1, MKP-1, PTPN10


Target Information

항목 내용
Target Protein Dual specificity phosphatase 1
Target Gene DUSP1
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000003977 (96%), Mouse ENSMUSG00000024190 (94%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Recommended Application - WB
Recommended Application - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.