CacheBy
Atlas Antibodies Anti-DUS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DUS2 Antibody

상품 한눈에 보기

Human DUS2 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit host에서 생성되었으며, PrEST 항원을 이용해 친화 정제됨. 인간 반응성이 검증되어 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043528-100 Anti-DUS2 Antibody, dihydrouridine synthase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043528-25 Anti-DUS2 Antibody, dihydrouridine synthase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DUS2 Antibody

Anti-DUS2 Antibody

Target Protein: dihydrouridine synthase 2
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Validation Note:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human DUS2.


Alternative Gene Names

DUS2L, FLJ20399, SMM1

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein dihydrouridine synthase 2
Target Gene DUS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000031901 (98%), Rat ENSRNOG00000019819 (96%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Antigen Sequence

SLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVLSTVDFVAPDDRVVFRTCEREQNRVVFQMGT

Safety Information

Material Safety Data Sheet - Sodium Azide


제품 이미지

Enhanced Validation
IHC Independent
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.