CacheBy
Atlas Antibodies Anti-DUS3L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DUS3L Antibody

상품 한눈에 보기

Human DUS3L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. 높은 종간 보존성을 가지며, PrEST 항원으로 친화 정제되었습니다. 인체, 생쥐, 랫드 시료 분석에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041944-100 Anti-DUS3L Antibody, dihydrouridine synthase 3-like (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041944-25 Anti-DUS3L Antibody, dihydrouridine synthase 3-like (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DUS3L Antibody

Anti-DUS3L Antibody

Target: dihydrouridine synthase 3-like (S. cerevisiae)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human DUS3L.


Alternative Gene Names

  • DUS3
  • FLJ13896

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein dihydrouridine synthase 3-like (S. cerevisiae)
Target Gene DUS3L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQ

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000007603 91%
Rat ENSRNOG00000050381 91%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.