AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DUS3L Antibody
상품 한눈에 보기
Human DUS3L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. 높은 종간 보존성을 가지며, PrEST 항원으로 친화 정제되었습니다. 인체, 생쥐, 랫드 시료 분석에 사용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041944-100 Anti-DUS3L Antibody, dihydrouridine synthase 3-like (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041944-25 Anti-DUS3L Antibody, dihydrouridine synthase 3-like (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DUS3L Antibody
Anti-DUS3L Antibody
Target: dihydrouridine synthase 3-like (S. cerevisiae)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human DUS3L.
Alternative Gene Names
- DUS3
- FLJ13896
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dihydrouridine synthase 3-like (S. cerevisiae) |
| Target Gene | DUS3L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQ |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000007603 | 91% |
| Rat | ENSRNOG00000050381 | 91% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.