
Atlas Antibodies Anti-DPPA5 Antibody
상품 한눈에 보기
Human DPPA5 단백질을 타겟으로 하는 폴리클로날 항체로, 배아줄기세포 관련 연구에 적합. Rabbit 유래 IgG 형태이며, PrEST 항원으로 친화 정제됨. 인체 반응성이 검증되었으며, Affinity purification 방식으로 높은 특이도 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DPPA5 Antibody
Target Protein: developmental pluripotency associated 5
Alternative Gene Name: Esg1
Supplier: Atlas Antibodies
Recommended Applications
Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human DPPA5.
Target Information
- Target Gene: DPPA5
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVS
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000000199): 75%
- Mouse (ENSMUSG00000060461): 73%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Verified Reactivity | Human |
| Alternative Gene Name | Esg1 |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Open Datasheet (PDF)
Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DPY19L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DPY19L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DPPA5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DPY19L1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DPT Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.