
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DPPA5 Antibody
상품 한눈에 보기
Human DPPA5 단백질을 타겟으로 하는 폴리클로날 항체로, 배아줄기세포 관련 연구에 적합. Rabbit 유래 IgG 형태이며, PrEST 항원으로 친화 정제됨. 인체 반응성이 검증되었으며, Affinity purification 방식으로 높은 특이도 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA064505-100 Anti-DPPA5 Antibody, developmental pluripotency associated 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064505-25 Anti-DPPA5 Antibody, developmental pluripotency associated 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DPPA5 Antibody
Anti-DPPA5 Antibody
Target Protein: developmental pluripotency associated 5
Alternative Gene Name: Esg1
Supplier: Atlas Antibodies
Recommended Applications
Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human DPPA5.
Target Information
- Target Gene: DPPA5
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVS
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000000199): 75%
- Mouse (ENSMUSG00000060461): 73%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Verified Reactivity | Human |
| Alternative Gene Name | Esg1 |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Open Datasheet (PDF)
Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



