CacheBy
Atlas Antibodies Anti-DPY19L2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DPY19L2 Antibody

상품 한눈에 보기

Human DPY19L2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 정제되었으며, 40% 글리세롤 및 PBS 완충액에 보존됩니다. 다양한 종 간 반응성 정보가 제공됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA078305-100 Anti-DPY19L2 Antibody, dpy-19 like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA078305-25 Anti-DPY19L2 Antibody, dpy-19 like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DPY19L2 Antibody

Anti-DPY19L2 Antibody

Target Information

  • Target Protein: dpy-19-like 2 (C. elegans)
  • Target Gene: DPY19L2
  • Alternative Gene Names: FLJ32949, SPATA34
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human DPY19L2.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KQGVSSKRLQSSGCSQSKGRRGASLAREPEVEEEM

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000063952 37%
Rat ENSRNOG00000028641 37%

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.