
Atlas Antibodies Anti-SH2D4A Antibody
상품 한눈에 보기
인간 SH2D4A 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원을 사용해 제작되었으며, 오소고날 검증으로 단백질 발현이 확인되었습니다. 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SH2D4A Antibody
SH2 domain containing 4A
Recommended Applications
- IHC (Orthogonal validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human SH2D4A
Alternative Gene Names
FLJ20967, PPP1R38, SH2A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SH2 domain containing 4A |
| Target Gene | SH2D4A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000013541 (73%), Mouse ENSMUSG00000053886 (73%) |
Antigen Sequence:
LFFKMREEQIRRWKEREAAMERKESLPVKPRPKKENGKSVHWKLGADKEVWVWVMGEHHLDKPYDVLCNEIIAERARLKAEQEAEEPRKTHSEEFTNSLKTKSQYHDLQAPDNQQTKDIWKKVA
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SH2D7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SH2D4B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SH2D4A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SH2D3C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SH2D4A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.