
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SH2D3C Antibody
상품 한눈에 보기
인간 SH2D3C 단백질을 타깃으로 하는 폴리클로날 항체. IHC 및 WB에 적합하며, RNA-seq 데이터 기반 직교 검증 완료. 토끼 유래 IgG로 제작되었으며, 친화 정제 방식으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA047586-100 Anti-SH2D3C Antibody, SH2 domain containing 3C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047586-25 Anti-SH2D3C Antibody, SH2 domain containing 3C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SH2D3C Antibody
Anti-SH2D3C Antibody
Target: SH2 domain containing 3C (SH2D3C)
Type: Polyclonal Antibody against Human SH2D3C
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression levels.
- WB (Western Blot)
Product Description
Polyclonal antibody raised in rabbit against human SH2D3C.
Validated for immunohistochemistry and western blot applications.
Alternative Gene Names
- NSP3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SH2 domain containing 3C |
| Target Gene | SH2D3C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SGAIIYCPVNRTFPLRYLEASYGLGQGSSKPASPVSPSGPKGSHMKRRSVTMTDGLTADKVTRSDGCPTSTSLPRPRDSIRSCALSMDQIPDLH |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (91%, ENSRNOG00000054560), Mouse (90%, ENSMUSG00000059013) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



