CacheBy
Atlas Antibodies Anti-SGSH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SGSH Antibody

상품 한눈에 보기

인간 SGSH 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 Orthogonal 검증 완료. Rabbit에서 생산된 IgG 항체이며, PrEST 항원 기반 친화 정제. 인간 특이 반응성을 보이며, 40% 글리세롤과 PBS 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023436-100 Anti-SGSH Antibody, N-sulfoglucosamine sulfohydrolase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023436-25 Anti-SGSH Antibody, N-sulfoglucosamine sulfohydrolase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SGSH Antibody

Anti-SGSH Antibody

Target Protein: N-sulfoglucosamine sulfohydrolase (SGSH)


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SGSH


Alternative Gene Names

HSS, MPS3A, SFMD

Open Datasheet


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    CEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPL

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000005043 92%
Rat ENSRNOG00000049552 69%

Antibody Characteristics

Parameter Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.