CacheBy
Atlas Antibodies Anti-SGPP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SGPP1 Antibody

상품 한눈에 보기

Human SGPP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응 특이성을 보입니다. 40% glycerol 기반 PBS buffer에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064908-100 Anti-SGPP1 Antibody, sphingosine-1-phosphate phosphatase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064908-25 Anti-SGPP1 Antibody, sphingosine-1-phosphate phosphatase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SGPP1 Antibody

Anti-SGPP1 Antibody

Target: sphingosine-1-phosphate phosphatase 1 (SGPP1)
Type: Polyclonal Antibody against Human SGPP1

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Open Datasheet


Target Information

항목 내용
Target Protein sphingosine-1-phosphate phosphatase 1
Target Gene SGPP1
Antigen Sequence KITIPLACKIFNIPCDDIRKARQHMEVELPYR
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Verified Species Reactivity Human
Interspecies Identity Mouse (84%), Rat (81%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.