AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SGK1 Antibody
상품 한눈에 보기
Human SGK1 단백질을 인식하는 Rabbit Polyclonal 항체로, serum/glucocorticoid regulated kinase 1 연구에 적합. 높은 종간 반응성(인간, 쥐, 생쥐 98%)을 보이며, PrEST 항원으로 친화 정제됨. 40% 글리세롤 및 PBS 완충액에 보존 처리됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051251-100 Anti-SGK1 Antibody, serum/glucocorticoid regulated kinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051251-25 Anti-SGK1 Antibody, serum/glucocorticoid regulated kinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SGK1 Antibody
Anti-SGK1 Antibody
Target Information
- Target Protein: serum/glucocorticoid regulated kinase 1
- Target Gene: SGK1
- Alternative Gene Names: SGK
Product Description
Polyclonal antibody against human SGK1 (serum/glucocorticoid regulated kinase 1).
Recommended Applications
- ICC (Immunocytochemistry)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
NILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSL
Species Reactivity
- Verified Reactivity: Human
- Interspecies Identity:
- Rat (ENSRNOG00000011815): 98%
- Mouse (ENSMUSG00000019970): 98%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.