
Atlas Antibodies Anti-SGK1 Antibody
상품 한눈에 보기
Human SGK1 단백질을 인식하는 Rabbit Polyclonal 항체로, serum/glucocorticoid regulated kinase 1 연구에 적합. 높은 종간 반응성(인간, 쥐, 생쥐 98%)을 보이며, PrEST 항원으로 친화 정제됨. 40% 글리세롤 및 PBS 완충액에 보존 처리됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SGK1 Antibody
Target Information
- Target Protein: serum/glucocorticoid regulated kinase 1
- Target Gene: SGK1
- Alternative Gene Names: SGK
Product Description
Polyclonal antibody against human SGK1 (serum/glucocorticoid regulated kinase 1).
Recommended Applications
- ICC (Immunocytochemistry)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
NILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSL
Species Reactivity
- Verified Reactivity: Human
- Interspecies Identity:
- Rat (ENSRNOG00000011815): 98%
- Mouse (ENSMUSG00000019970): 98%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
