CacheBy
Atlas Antibodies Anti-SGK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SGK2 Antibody

상품 한눈에 보기

Human SGK2 단백질을 타깃으로 하는 Rabbit Polyclonal Antibody. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 Affinity 정제됨. Human에 대해 검증된 반응성을 가지며, Mouse 및 Rat과 93% 서열 유사성. 40% glycerol 기반 PBS buffer에 sodium azide 보존제 포함. 연구용으로 최적화된 고품질 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008859-100 Anti-SGK2 Antibody, serum/glucocorticoid regulated kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008859-25 Anti-SGK2 Antibody, serum/glucocorticoid regulated kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SGK2 Antibody

Anti-SGK2 Antibody

Target Information

  • Target Protein: Serum/Glucocorticoid Regulated Kinase 2
  • Target Gene: SGK2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPD

Verified Species Reactivity

  • Human

Interspecies Information

  • Mouse ENSMUSG00000017868 (93%)
  • Rat ENSRNOG00000033573 (93%)

Product Description

Polyclonal Antibody against Human SGK2
Open Datasheet

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

면역세포화학 (ICC) 등 다양한 연구 응용에 적합.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.