
Atlas Antibodies Anti-SERPINE3 Antibody
상품 한눈에 보기
Human SERPINE3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 40% 글리세롤 기반 PBS 버퍼에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SERPINE3 Antibody
Target: serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human SERPINE3.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3 |
| Target Gene | SERPINE3 |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000009814 (83%), Mouse ENSMUSG00000091155 (79%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | VLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTASTIHLWTTSLRRARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGI |
Purification & Buffer
| 항목 | 내용 |
|---|---|
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SERTAD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SERTAD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SERPINE3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SERTAD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SERPINH1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.