CacheBy
Atlas Antibodies Anti-SERPINE3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SERPINE3 Antibody

상품 한눈에 보기

Human SERPINE3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 40% 글리세롤 기반 PBS 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA055804-100 Anti-SERPINE3 Antibody, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055804-25 Anti-SERPINE3 Antibody, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SERPINE3 Antibody

Anti-SERPINE3 Antibody

Target: serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human SERPINE3.

Open Datasheet

Target Information

항목 내용
Target Protein serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3
Target Gene SERPINE3
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000009814 (83%), Mouse ENSMUSG00000091155 (79%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence VLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTASTIHLWTTSLRRARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGI

Purification & Buffer

항목 내용
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.