Atlas Antibodies Anti-SERPINE3 Antibody

상품 한눈에 보기

Human SERPINE3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 40% 글리세롤 기반 PBS 버퍼에 보존제로 sodium azide 포함.

카탈로그번호: HPA055804-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA055804-100 Anti-SERPINE3 Antibody, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA055804-25 Anti-SERPINE3 Antibody, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SERPINE3 Antibody

Anti-SERPINE3 Antibody

Target: serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG

Recommended Applications

Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human SERPINE3.

Open Datasheet

Target Information

항목	내용
Target Protein	serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3
Target Gene	SERPINE3
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000009814 (83%), Mouse ENSMUSG00000091155 (79%)

Antigen Information

항목	내용
Antigen Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	VLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTASTIHLWTTSLRRARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGI

Purification & Buffer

항목	내용
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2)
Preservative	0.02% sodium azide (Material Safety Data Sheet)