Atlas Antibodies Anti-SERPINH1 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA029198-100 | - | Atlas Antibodies HPA029198-100 Anti-SERPINH1 Antibody, serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1) 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA029198-25 | - | Atlas Antibodies HPA029198-25 Anti-SERPINH1 Antibody, serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1) 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-SERPINH1 Antibody
serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human SERPINH1
Alternative Gene Names
CBP1, CBP2, colligen, HSP47, SERPINH2
Target Protein
serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
Target Gene
SERPINH1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
LSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKL
Verified Species Reactivity
Human, Mouse
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000070436 (89%)
Rat ENSRNOG00000016831 (88%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|