CacheBy
Atlas Antibodies Anti-SERPINH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SERPINH1 Antibody

상품 한눈에 보기

Human SERPINH1(HSP47) 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. siRNA knockdown으로 유전적 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA029198-100 Anti-SERPINH1 Antibody, serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029198-25 Anti-SERPINH1 Antibody, serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SERPINH1 Antibody

Anti-SERPINH1 Antibody

serpin peptidase inhibitor, clade H (heat shock protein 47), member 1 (collagen binding protein 1)


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SERPINH1.


Alternative Gene Names

CBP1, CBP2, Colligen, HSP47, SERPINH2


Target Information

항목 내용
Target Protein serpin peptidase inhibitor, clade H (heat shock protein 47), member 1 (collagen binding protein 1)
Target Gene SERPINH1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKL
Verified Species Reactivity Human, Mouse
Interspecies Identity Mouse ENSMUSG00000070436 (89%), Rat ENSRNOG00000016831 (88%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC
WB
Genetic Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.