
Atlas Antibodies Anti-SEPT12 Antibody
상품 한눈에 보기
Human SEPT12 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 재조합 발현 검증을 통해 높은 특이성과 신뢰성을 제공합니다. 글리세롤 완충액 형태로 장기 보관이 용이합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SEPT12 Antibody
Target Protein: septin 12
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- WB (Recombinant Expression Validation): 검증된 재조합 발현 단백질을 이용한 Western blot 검증
- ICC: 면역세포화학(ICC)에 사용 가능
Product Description
Polyclonal antibody against Human SEPT12.
Alternative Gene Names
- FLJ25410
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
IHYENYRVIRLNESHLLPRGPGWVNLAPASPGQLTTPRTFKVCRGAHDDSDDEF
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000003137 | 70% |
| Mouse | ENSMUSG00000033852 | 26% |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
- Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SEPT6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEPT5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEPT12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEPT14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEPHS2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.