CacheBy
Atlas Antibodies Anti-SEPHS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SEPHS2 Antibody

상품 한눈에 보기

Human SEPHS2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 PrEST 항원으로 친화 정제됨. 40% glycerol 기반 PBS 버퍼에 sodium azide 보존제 포함. Human에 대한 검증된 반응성과 높은 특이성 제공.

카탈로그번호
HPA047931-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047931-100 Anti-SEPHS2 Antibody, selenophosphate synthetase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047931-25 Anti-SEPHS2 Antibody, selenophosphate synthetase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEPHS2 Antibody

Anti-SEPHS2 Antibody

Target: selenophosphate synthetase 2
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SEPHS2.

Alternative Gene Names

  • SPS2
  • SPS2b

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein selenophosphate synthetase 2
Target Gene SEPHS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (62%), Rat (36%)

Antigen Sequence:
KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGI

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Safety Data Sheet MSDS - Sodium Azide

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Recommended
ICC Recommended

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.