CacheBy
Atlas Antibodies Anti-SEPHS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SEPHS2 Antibody

상품 한눈에 보기

Human SEPHS2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 PrEST 항원으로 친화 정제됨. 40% glycerol 기반 PBS 버퍼에 sodium azide 보존제 포함. Human에 대한 검증된 반응성과 높은 특이성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA047931-100 Anti-SEPHS2 Antibody, selenophosphate synthetase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047931-25 Anti-SEPHS2 Antibody, selenophosphate synthetase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEPHS2 Antibody

Anti-SEPHS2 Antibody

Target: selenophosphate synthetase 2
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SEPHS2.

Alternative Gene Names

  • SPS2
  • SPS2b

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein selenophosphate synthetase 2
Target Gene SEPHS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (62%), Rat (36%)

Antigen Sequence:
KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGI

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Safety Data Sheet MSDS - Sodium Azide

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Recommended
ICC Recommended

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.