Atlas Antibodies Anti-SEMA3E Antibody
상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA029419-100 | - | Atlas Antibodies HPA029419-100 Anti-SEMA3E Antibody, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA029419-25 | - | Atlas Antibodies HPA029419-25 Anti-SEMA3E Antibody, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-SEMA3E Antibody
sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E
Recommended Applications
Product Description
Polyclonal Antibody against Human SEMA3E
Alternative Gene Names
coll-5, KIAA0331, M-SemaK, SEMAH
Target Protein
sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E
Target Gene
SEMA3E
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
MDLGLLFLRLHKSDAGTYFCQTVEHSFVHTVRKITLEVVEEEKVEDMFNKDDEEDRHHRMPCPAQSSISQGAKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDRKRKKLKMSPSKWKYANPQEKKLRSKPEHYR
Verified Species Reactivity
Human, Mouse
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000006631 (86%)
Mouse ENSMUSG00000063531 (86%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|