Atlas Antibodies Anti-SEMA3D Antibody
| 상품 옵션 정보 | |||||||
|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA037522-100 | Atlas Antibodies HPA037522-100 Anti-SEMA3D Antibody, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA037522-25 | Atlas Antibodies HPA037522-25 Anti-SEMA3D Antibody, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-SEMA3D Antibody
sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D
Recommended Applications
Product Description
Polyclonal Antibody against Human SEMA3D
Alternative Gene Names
coll-2, Sema-Z2
Target Protein
sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D
Target Gene
SEMA3D
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
LYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVG
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000007202 (93%)
Mouse ENSMUSG00000040254 (91%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|