
Atlas Antibodies Anti-SEC24D Antibody
상품 한눈에 보기
Rabbit polyclonal antibody against human SEC24D protein. Affinity purified using PrEST antigen. Suitable for immunohistochemistry and other research applications. High sequence identity with rat and mouse orthologs. Supplied in PBS with 40% glycerol an...
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SEC24D Antibody
Target: SEC24 family member D
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Other research applications
Product Description
Polyclonal antibody against human SEC24D.
Alternative Gene Names
- KIAA0755
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SEC24 family member D |
| Target Gene | SEC24D |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ASQLILPDSMKVLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVKSTMLPAAVRCSESRLS |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 | 항원 서열 일치율 |
|---|---|---|
| Rat | ENSRNOG00000014872 | 93% |
| Mouse | ENSMUSG00000039234 | 92% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SEC62 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEC61B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEC24D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEC31B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEC31A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.