
Atlas Antibodies Anti-SEC31A Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human SEC31A protein. Validated for IHC and ICC applications. High sequence identity with mouse and rat orthologs. Affinity purified using PrEST antigen for high specificity. Supplied in 40% glycerol with PBS buffer.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SEC31A Antibody
Target: SEC31 homolog A (S. cerevisiae)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human SEC31A.
Alternative Gene Names
ABP125, ABP130, KIAA0905, SEC31L1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SEC31 homolog A (S. cerevisiae) |
| Target Gene | SEC31A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (93%), Rat (92%) |
Antigen Sequence:
NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 상세 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SEC24D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEC31B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEC31A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEC31B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEC24C Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.