Thermo Fisher Scientific CAND1 Polyclonal Antibody
CAND1 단백질을 인식하는 Rabbit Polyclonal 항체로, Western Blot 및 IHC(Paraffin) 실험에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며 PBS/glycerol buffer에 보존됩니다. 인간 시료에 반응하며 연구용으로만 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.04–0.4 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:1,000–1:2,500 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human CAND1. Recombinant protein control fragment (Product #RP-103473) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Wet ice |
| RRID | AB_2639264 |
Product Specific Information
Immunogen sequence:
QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPG
Highest antigen sequence identity to the following orthologs:
- Mouse: 98%
- Rat: 100%
Target Information
CAND1 enhances transcription from various types of promoters. It is a regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins.
CAND1 prevents neddylation of CUL1 by physically blocking access to the neddylation site and disrupts interactions between CUL1 and SKP1A as well as between CUL1 and F-box proteins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific TRPV6 Polyclonal Antibody
876,300원
Thermo Fisher Scientific
Thermo Fisher Scientific HOXB13 Polyclonal Antibody
796,700원
Thermo Fisher Scientific
Thermo Fisher Scientific CAND1 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific ODF3B Polyclonal Antibody
796,700원
Thermo Fisher Scientific
Thermo Fisher Scientific ZNF579 Polyclonal Antibody
773,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|