
Thermo Fisher Scientific Zfp566 Polyclonal Antibody
Thermo Fisher Scientific의 Zfp566 Polyclonal Antibody는 Rat에서 반응하며 Rabbit IgG 기반의 비결합형 항체입니다. Western blot에 사용 가능하며, Affinity chromatography로 정제되었습니다. 0.5 mg/mL 농도로 PBS + 2% sucrose buffer에 보관됩니다. 연구용으로만 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB)
Tested Dilution: 1.0 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the following sequence: YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2691122 |
Product Specific Information
This target displays homology in the following species:
Cow: 93%, Dog: 93%, Guinea Pig: 86%, Horse: 100%, Human: 100%, Mouse: 100%, Pig: 93%, Rabbit: 93%, Rat: 100%, Zebrafish: 93%
Target Information
Zfp566 gene ontology annotations related to this gene include regulation of transcription, DNA-templated.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific SnoN Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific GTF2B Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific Zfp566 Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific KLF15 Polyclonal Antibody
657,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ZHX3 Polyclonal Antibody
642,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|