원본
Thermo Fisher Scientific Zfp566 Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 Zfp566 Polyclonal Antibody는 Rat에서 반응하며 Rabbit IgG 기반의 비결합형 항체입니다. Western blot에 사용 가능하며, Affinity chromatography로 정제되었습니다. 0.5 mg/mL 농도로 PBS + 2% sucrose buffer에 보관됩니다. 연구용으로만 사용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 06:22
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA570376 Zfp566 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
642,300원VAT 포함 706,530원
Thermo Fisher Scientific · Thermo Fisher Scientific Zfp566 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 1.0 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the following sequence: YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2691122 |
Product Specific Information
This target displays homology in the following species:
Cow: 93%, Dog: 93%, Guinea Pig: 86%, Horse: 100%, Human: 100%, Mouse: 100%, Pig: 93%, Rabbit: 93%, Rat: 100%, Zebrafish: 93%
Target Information
Zfp566 gene ontology annotations related to this gene include regulation of transcription, DNA-templated.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific SnoN Polyclonal Antibody642,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific GTF2B Polyclonal Antibody642,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific KLF15 Polyclonal Antibody657,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ZHX3 Polyclonal Antibody642,300원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.