Thermo Fisher Scientific TBLR1 Polyclonal Antibody
TBLR1 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB 및 IHC(P) 실험에 적합합니다. 인간, 생쥐, 랫트 시료에서 검출 가능하며, 비결합형 액상 형태로 제공됩니다. 단기 4°C, 장기 -20°C 보관 권장.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific TBLR1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1–3 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | Assay-dependent |
Product Specifications
| Specification | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide WPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWT, corresponding to amino acids 200–250 of Human TBLR1 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2199912 |
Product Specific Information
PA1-29834 detects TBLR1 from rat, mouse, and human samples.
Target Information
Chromatin organization plays a fundamental role in regulating transcription in eukaryotic cells. The nuclear receptor corepressor (N-CoR) and silencing mediator of retinoid and thyroid hormone receptors (SMRT) are involved in transcriptional repression pathways.
N-CoR and SMRT form large protein complexes that recruit histone deacetylases (HDACs) to create repressive chromatin. HDAC3 is the main HDAC associated with these complexes and is essential for repression.
TBLR1 is a WD-40 repeat protein that associates with N-CoR and SMRT complexes. Although TBLR1 is considered a core component of both complexes, its exact role remains to be elucidated.
Usage Note
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific TXNDC5 Polyclonal Antibody
783,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SETD7 Polyclonal Antibody
783,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TBLR1 Polyclonal Antibody
886,700원
Thermo Fisher Scientific
Thermo Fisher Scientific SMAD6 Polyclonal Antibody
783,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SMAD9 Polyclonal Antibody
710,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|