
Thermo Fisher Scientific TBLR1 Polyclonal Antibody
TBLR1 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB 및 IHC(P) 실험에 적합합니다. 인간, 생쥐, 랫트 시료에서 검출 가능하며, 비결합형 액상 형태로 제공됩니다. 단기 4°C, 장기 -20°C 보관 권장.
- 카탈로그번호
- PA129834
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific TBLR1 Polyclonal Antibody
Thermo Fisher Scientific TBLR1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1–3 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | Assay-dependent |
Product Specifications
| Specification | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide WPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWT, corresponding to amino acids 200–250 of Human TBLR1 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2199912 |
Product Specific Information
PA1-29834 detects TBLR1 from rat, mouse, and human samples.
Target Information
Chromatin organization plays a fundamental role in regulating transcription in eukaryotic cells. The nuclear receptor corepressor (N-CoR) and silencing mediator of retinoid and thyroid hormone receptors (SMRT) are involved in transcriptional repression pathways.
N-CoR and SMRT form large protein complexes that recruit histone deacetylases (HDACs) to create repressive chromatin. HDAC3 is the main HDAC associated with these complexes and is essential for repression.
TBLR1 is a WD-40 repeat protein that associates with N-CoR and SMRT complexes. Although TBLR1 is considered a core component of both complexes, its exact role remains to be elucidated.
Usage Note
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
