
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DOCK6 Antibody
상품 한눈에 보기
Human DOCK6 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 affinity purification 되었으며, 높은 종간 반응 특이성을 제공합니다. 연구용으로 최적화된 고품질 항체입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049424-100 Anti-DOCK6 Antibody, dedicator of cytokinesis 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049424-25 Anti-DOCK6 Antibody, dedicator of cytokinesis 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DOCK6 Antibody
Anti-DOCK6 Antibody
Target: dedicator of cytokinesis 6 (DOCK6)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human DOCK6 protein, designed for research use.
Alternative Gene Names
KIAA1395, ZIR1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dedicator of cytokinesis 6 |
| Target Gene | DOCK6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LYLPLLSIARDTLPRLHDFAEGPGQRSRLASMLDSDTEGEGDIAGTINPSVAMAIAGGPLAPGSRASISQGPPTASRAGCALSAESSRTLLACVLWVL |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000010652 (90%), Mouse ENSMUSG00000032198 (88%) |
Purification & Buffer
| 항목 | 내용 |
|---|---|
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



