
Atlas Antibodies Anti-DOCK6 Antibody
상품 한눈에 보기
Human DOCK6 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 affinity purification 되었으며, 높은 종간 반응 특이성을 제공합니다. 연구용으로 최적화된 고품질 항체입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DOCK6 Antibody
Target: dedicator of cytokinesis 6 (DOCK6)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human DOCK6 protein, designed for research use.
Alternative Gene Names
KIAA1395, ZIR1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dedicator of cytokinesis 6 |
| Target Gene | DOCK6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LYLPLLSIARDTLPRLHDFAEGPGQRSRLASMLDSDTEGEGDIAGTINPSVAMAIAGGPLAPGSRASISQGPPTASRAGCALSAESSRTLLACVLWVL |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000010652 (90%), Mouse ENSMUSG00000032198 (88%) |
Purification & Buffer
| 항목 | 내용 |
|---|---|
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
