CacheBy
Atlas Antibodies Anti-DOCK6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DOCK6 Antibody

상품 한눈에 보기

Human DOCK6 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 affinity purification 되었으며, 높은 종간 반응 특이성을 제공합니다. 연구용으로 최적화된 고품질 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049424-100 Anti-DOCK6 Antibody, dedicator of cytokinesis 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049424-25 Anti-DOCK6 Antibody, dedicator of cytokinesis 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DOCK6 Antibody

Anti-DOCK6 Antibody

Target: dedicator of cytokinesis 6 (DOCK6)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human DOCK6 protein, designed for research use.


Alternative Gene Names

KIAA1395, ZIR1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein dedicator of cytokinesis 6
Target Gene DOCK6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LYLPLLSIARDTLPRLHDFAEGPGQRSRLASMLDSDTEGEGDIAGTINPSVAMAIAGGPLAPGSRASISQGPPTASRAGCALSAESSRTLLACVLWVL
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000010652 (90%), Mouse ENSMUSG00000032198 (88%)

Purification & Buffer

항목 내용
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.