CacheBy
Atlas Antibodies Anti-DOCK8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DOCK8 Antibody

상품 한눈에 보기

Human DOCK8 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. Rabbit 호스트에서 생산되었으며, Affinity purified 방식으로 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073349-100 Anti-DOCK8 Antibody, dedicator of cytokinesis 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073349-25 Anti-DOCK8 Antibody, dedicator of cytokinesis 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DOCK8 Antibody

Anti-DOCK8 Antibody

Target Protein: dedicator of cytokinesis 8 (DOCK8)

  • IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal Antibody against Human DOCK8

Alternative Gene Names

FLJ00026, FLJ00152, FLJ00346, ZIR8

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

INRYSSAEIRKQFTLPPNLGQYHRQSISTSGFPSLQLPQFYDPVEPVDFEGLLMTHLNSLDVQLAQELGDFTDDDLDVVF

Verified Species Reactivity

Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000052085 88%
Rat ENSRNOG00000015894 86%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.