
Atlas Antibodies Anti-DEFA5 Antibody
상품 한눈에 보기
Human DEFA5 단백질을 인식하는 토끼 유래 폴리클로날 항체로, 면역세포 내 DEFA5 검출에 적합. PrEST 항원을 이용해 친화 정제되었으며, 인체 반응성이 검증됨. PBS와 글리세롤 기반 보존 용액에 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DEFA5 Antibody
Overview
Polyclonal antibody against human defensin alpha 5 (DEFA5).
Alternative gene names: DEF5, HD-5
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
- Polyclonal antibody generated in rabbit
- Verified reactivity: Human
- Highest antigen sequence identity to rat ortholog (ENSRNOG00000030093, 49%)
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | defensin alpha 5 |
| Target Gene | DEFA5 |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Purification | Affinity purified using PrEST antigen |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (49%) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
- Material Safety Data Sheet
- Open Datasheet (PDF)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DEFB104A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DEF6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DEFA5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DEFA6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DEFA1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.